PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA21G00326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 630aa    MW: 70064.1 Da    PI: 6.3614
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA21G00326genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822150.81.1e-46642041133
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl..eeaeaagssas..aspes 92 
                 ggs+r+++ +E+E++k+RER+RRai+a+i+ GLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g k +  ++a+aagssas  +s+++
  AA21G00326  64 GGSRRSRPLEEKERTKLRERHRRAITARILGGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsksQGIKLPggSSAAAAGSSAShmVSQQN 162
                 689******************************************************************976666676688788888888776667777 PP

      DUF822  93 slq.sslkssalaspvesysaspksssfpspssldsislasa 133
                 s   ++ +ss ++spv+  s+ +k + +p++s +d  + a a
  AA21G00326 163 SPPaLRGVSSGQRSPVDFNSCHMKGVFTPAQSPYDLPQPARA 204
                 7666999***************************98766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-3865199IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514453.82E-137246627IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.806.7E-97249447IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.3E-55255448IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-32286300IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-32307325IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-32329350IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060333341IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR007501.7E-32422444IPR001554Glycoside hydrolase, family 14
Gene3DG3DSA:3.20.20.802.4E-47448627IPR013781Glycoside hydrolase, catalytic domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MSADMQKLLG TSEEDDDEDM DMDVKEEDDR DQQSRRTHLA SGSSNEEFMF QQSMQEQVGT  60
PGGGGSRRSR PLEEKERTKL RERHRRAITA RILGGLRRHG NYNLRVRADI NDVIAALARE  120
AGWVVLPDGT TFPSKSQGIK LPGGSSAAAA GSSASHMVSQ QNSPPALRGV SSGQRSPVDF  180
NSCHMKGVFT PAQSPYDLPQ PARAQSPELV SGVNKADGQS LVGCSVNVIN AKQIPEIPPI  240
LTEQDFSGTP YVPVYVMLPL GVINMKCELA DRDGLLKHLR ILKSLHIDGV KVDCWWGIVE  300
GHSPREYNWN GYRQLFQMVC DLNLKIQVLM SFHECGGNVG DDVCIPLPHW VAEIGRTNPD  360
IYFTDREGRR NPECLSWGID KERVLRGRTA LEVYFDYMRS FRIELAEFLE GGVISMVEIG  420
LGPCGELRYP SCPIKHGWRY PGVGEFQVLI DHADQILSLA KLVFDSSCIA VKLPDVHWWY  480
RTASHAAELT AGFYNPSNRD GYAAIASTLK KHGATLSFAS GEVQVLNRPD DFSGSLGEPE  540
AVAWQVLNAA WDTNTAIARE NSLPCHDRVG YNKMLESVKF PSDPDRRQLS SFAYSRLVPG  600
LMEGQNIVEF ERFVKKLHGE AVMDHHHHHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1fa2_A1e-10125162012446BETA-AMYLASE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2273230.0AK227323.1 Arabidopsis thaliana mRNA for putative beta-amylase, complete cds, clone: RAFL14-01-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397762.10.0hypothetical protein EUTSA_v10001342mg
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLV4KMT30.0V4KMT3_EUTSA; Beta-amylase
STRINGAT2G45880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29452535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7